Eagle TimeRegisterLogin

The Grand OC SII: The Re-OCening: Week 29: UNINTELLIGIBLE!
Author Message
Dragon Fogel
 RE: The Grand OC SII: The Re-OCening: Week 27: PIRATE!
The Goddamn Pacman

Online
Posts: 8,101
Joined: Jul 2011
Name: Penelope
Gender: Female
Race: Human
Text Color: #2E8B57
Biography: Aye, I know that woman. She was on our crew for a while. 'Twas a rainy night when she came to us, and she was drenched. Said she'd gotten mixed up in an arranged marriage, and she wanted to get out before her new in-laws could find where she was.
Seemed a bit odd, really. She looked too shabby to be involved with anyone who could afford to chase after her. Still, she had some good coin on her, so the captain agreed. Provided she helped out on the ship in the meantime, of course.
We called her Penny at first, but she soon made it clear she didn't care for that name. Might not have thought it to look at her, but she was a fierce one when she got angry. Floored the first mate in an instant.
That's when the captain asked if she wanted to be a pirate.
We only brought Penelope along on one raid. 'Twas a few months after she came to use. We'd heard that a ship was passing through our waters with valuable cargo. So we readied ourselves to ambush them.
And Penelope more than pulled her weight in that raid, let me tell ye. Never seen anyone, man or woman, wield a cutlass like she did. She practically handled half the fightin' herself.
The captain was so pleased he offered her first pick of the cargo. Which turned out to be just a big pile of bedding. Cap'n apologized for the mistake, said he'd defer it to next raid, but she wouldn't have it. If this was what they had to plunder, she was going to plunder it. Besides, she figured, it was probably at least expensive bedding.
So she took twenty mattresses and twenty feather-beds. Didn't trust us not to dirty 'em up if they were in the hold, so Penelope just stuffed 'em into her cabin. Said she'd sleep on 'em until a good chance to sell came along.
And that was it for a few weeks or so. We were stopping in a foreign port, hopin' to get rid of stuff that might cause us trouble later.
Except, right in the middle of the night, Penny runs out of her room and into the kitchen, and starts threatenin' the chef. She's miffed because one single pea got under all her beddin', and seems it was keepin' her up. Can you believe it?
Well. We calmed her down, hoped that was the end of it. But when we checked on her in the morning, she was gone.
So were the mattresses, at that.

Description: Penelope wasn't a bad-looking lass, though she always dressed simply. I remember she complained about high society ladies, always bein' focused on appearances. Seemed like a real sore point with her, though I couldn't say why.
Even when she joined the crew, she took the filthiest rags she could find and wore those. Can't say it hurt her in that fight, though. I'd give my last tooth to be half that agile.
Still, I couldn't help but get the sense she was hidin' something. When she wasn't mad, she was damned polite. Really, it was a little unnervin' when you consider we pirates are usually a rude bunch.
'Course, as I said. When she got mad, she got real mad. Wouldn't matter how many apologies you offered, at least not until she'd given you a good thrashing.

Weapons and Abilities: Aye, a real fierce fighter, she was. Don't know where she learned to swordfight, but she was amazin'. And not half-bad with just her fists. Hells, I think she just has a knack for fightin', wouldn't surprise me if she could pick up any old weapon and be decent with it. But I couldn't tell ye for sure.
And that was when she was calm! When you got that woman mad, my, my, she became an unstoppable beast. Aye, the poor chef was scared out of his wits for weeks afterwards. Half-convinced she'd pop up again and ambush him.
No idea where she is now. Probably sold those mattresses, I can't imagine it'd do her much good to keep luggin' them around.
Still can't believe she felt one single pea under all that mess. That's amazin'. Must have some real sensitive skin, I suppose.
07-01-2017, 12:08 AM
Find Quote this message in a reply
AgentBlue
 RE: The Grand OC SII: The Re-OCening: Week 27: PIRATE!
that escalated quickly

Offline
Posts: 4,275
Joined: Jul 2011
Sunshine, Lollipops and Diabetes
Username: Agennumbers
Name: That One Bit (Bit for short)
Species: Helpful Impossibility
Gender: None
Color: beep

Description: Hello! I am part of the Individualized Computational Universe Project, initialized... initialized... initialized...

I'm sorry! I don't think I can find that data for you right now! Please let us know of any other inquiries you may need to know at one of our helpful red and blue cube-interfaces!

Items/Abilities: The red and green ones are for materials synthesis, the red and purple ones are for materials collection and analysis, and the red and yellow ones are for communications!

I'm sorry! Communications seem to be down at the moment! We will be investigating this problem as soon as we can!

Biography: I'm sorry! I don't know why communications are down! Your UNIVERSE does not appear to be COMPATIBLE with our MATHEMATICAL MATHEMATICAL MATHEMATICAL MATHEMATICAL MATHEMATICAL D-descent rate transverse constants WRONG WRONG WRONG 3 3 3 3 3 3 3 3 and a BIT BIT BIT BIT BIT BIT BIT not COMPATIBLE not COMPATIBLE YOUR DIMENSIONS ARE WRONG WRONG WRONG cannot FIT FIT FIT FIT FIT FIT

I'm sorry! I don't think we can work together! Please hand over your belongings for analysis to the nearest red and purple cube-interface! CUBE CUBE CUBE SPHERE CUBE Please hand over your belongings! CONVERSION RATE: 0?% RATE OF CONVERSION TO CORRECT CONSTANTS: 0/% 3 and a BIT BIT BIT 141 Please hand over your belongings! Please hand over your BELONGINGS THIS IS NOT A CHOICE PLEASE HAND OVER YOUR BIT BIT BIT YOU ARE WRONG YOUR UNIVERSE IS WRONG
07-02-2017, 04:10 AM
Find Quote this message in a reply
seedy
 RE: The Grand OC SII: The Re-OCening: Week 27: PIRATE!
Sol Heir

Offline
Posts: 242
Joined: Dec 2011
Username: seedbeard
Name: Josie
Species: Shoulder-perching Macaw
Gender: eggs
Color: pretty green feathers

Biography: When the Pirate-Lord of the Eastern Sea, old Jack Canterbury himself died, stabbed through the heart seven times by the navy's bayonets, they said his parrot, his favorite Josie, took straight off and flew away, despite that they were in the middle of the ocean and there was no land for leagues. They say how young Adelaide White got her start is, it found her, sent by her dead master to reach his true successor and whisper all his secrets into their ear. And after all, she did have the ruby signet-ring that Jack himself hacked off the Bloody Duke's finger. When she finally went to the gallows, the bird landed on the frame, cawed once, and flew off amid the gunfire.

It disappears for a bit here, or at least the more myopic historians say so. Around this time, the Western Sea's Broken Strait is troubled by the Green Fleet, whose general was said to possess a green bird unlike any seen in the area. Half the world away from Slatecliff, but then this parrot did fly out over the ocean at one point.

A decade later we see Copper Kelly, the last of the great pirates. Green bird on her shoulder, just like the old days. When her ships were chased into that hurricane, never to be found again, well, that's when most historians say the Age of Piracy ended. The conspiracy theorists say that's when the bird finally died. Me, well...I think it just hasn't found the right person yet.

Abilities: Josie knows what you want, that unfettered greed, gluttony, lust for glory and power deep in your heart. She knows how easy it would be for you to get it.
(This post was last modified: 07-04-2017, 04:55 AM by seedy.)
07-04-2017, 04:54 AM
Find Quote this message in a reply
Schazer
 RE: The Grand OC SII: The Re-OCening: Week 27: PIRATE!
Patron Saint of Normcore

Offline
Posts: 6,739
Joined: Jul 2011
Ōtautahi
Username: Skay-Zer
Name: Riposte
Species: Metahuman
Gender: Digital Rebrolution
Color: Cybergrimes

Description: A strapping young elf with aggressively awesome hair and urban warpaint, the kind that breaks your face up so the cameras can't grok your facial features. Riposte's eyes shine an unnatural flickering blue, and cables and panels seem to sprout from behind his ears like a beautiful shitty halo. A couple of cables dangle down to each hip, where a boxy projector-like device sits. His lower left arm is an off-the-shelf mechanical prosthetic, kitted up with air-keyboard recognition sensors on his fingers and stripes of news tickers. It's a really nice bunch of upgrades, made by some really nice friends of his who probably want their shit back.

Riposte completes his look with a bandanna covering his lower face, black hooded sweater with one-way transparency in the hood lining, sturdy workin boots, and a duffel bag strapped tightly to his back.

Biography: <Stricken from the archives, later vandalized by the former "friends" Riposte left in the lurch>

Weapons/Abilities: Riposte's stolen some very, very fancy technology from some folks who would do a lot of murder to get it back, which gives him the ability to make an encrypted copy of any audio, physical object, or two-dimensional visual (for the duration he can focus his oculars on it). A duffel bag full of grape-sized sticky projectors, keyed to the encryption, can each be sync'd with a single probably-illegal download and made to broadcast it - physical objects are re-broadcasted as holograms.

Also he's got a gun because who doesn't in this day and age
07-07-2017, 08:10 AM
Find Quote this message in a reply
Mirdini
 RE: The Grand OC SII: The Re-OCening: Week 27: PIRATE!
You're Alright

Offline
Posts: 1,778
Joined: Jul 2011
Strudel Central
(Finally) time for some judgement!

The Lucky VII All-Rounder Award goes to Dragon Fogel/Penelope for a generally solid pirate profile probably filled with bad puns I missed on top of the ones I did catch.

The The Thomas Packston Elementalist Award goes to Pharmacy/Pirate Queen-Duchess Rhubarb Apple-Crisp III, Consumer of Confections, Nemesis of Felines, Vanquisher of Men, Okay-Writer of Love Songs, SCOURGE OF THE CELESTIAL SEAS, Esq. for her quintessential pirate wrapped up in a small furry dream bundle.

The Glere Award For Kitchen Sinkery goes to Agen/That One Bit for a contestant that threw me for a loop and narrowly avoided a Krachting for that awful acronym.

The Arnold Fogge's Actually Practical Award goes to Schazer/Riposte for a presumably rude jocknerd who should do pretty well in the wild and varied setting of a battle with that magitech. Also, GUN.

The Convolution Teamfriendliness Cup goes to Seedy/Josie for the pirrot who just won't quit (cawing in other contestants' ears about how they DESERVE SO MUCH MORE).
07-23-2017, 09:44 AM
Find Quote this message in a reply
Dragon Fogel
 RE: The Grand OC SII: The Re-OCening: Week 27: PIRATE!
The Goddamn Pacman

Online
Posts: 8,101
Joined: Jul 2011
The only intentional pun in mine was that Penelope is pea-irate.
07-23-2017, 01:34 PM
Find Quote this message in a reply
Solaris
 RE: The Grand OC SII: The Re-OCening: Week 27: PIRATE!
Lonely Rolling Star

Offline
Posts: 1,924
Joined: Jul 2011
Imagine Cucumber
oh
[Image: AmZKO5z.png]

I wanna be a real friend, Don't wanna break when I bend
I wanna a be no seeker, I wanna scream eureka
07-25-2017, 09:44 AM
Find Quote this message in a reply
Dragon Fogel
 RE: The Grand OC SII: The Re-OCening: Week 28: WARD!
The Goddamn Pacman

Online
Posts: 8,101
Joined: Jul 2011
Name: Caros
Gender: Has no understanding of the concept
Species: Miniature Golem
Text Color: Gold

Biography: No one can say for sure just when the golems were first made.
But year after year, a new group of them would wander out of the old school grounds, and they would soon split off, each seeking their new charges.
One went to the wisest in all the land; another to the strongest; another to the bravest; yet another to the kindest. More than a few disputes arose from those who did not see their own golem, but in the end, the golems themselves were always unmoved by such appeals.
But this year, Caros stayed perfectly still as its kin wandered off to seek their charges. Caros knew, instinctively, that its charge was nowhere in this world.
Soon enough, however, its chance to meet its proper charge would come.

Description: Caros is a small humanoid golem with a golden coating over its body. Caros has no real objectives other than meeting and protecting the one being in all existence that it deems worth the title of "Grandest Battler".
However, it has not yet been able to judge the competitors for the title, and so it will aim to observe them at first before making its decision.

Weapons and Abilities: Caros has incredible strength for its tiny size, but it rarely uses its power offensively.
Its primary powers are defensive. It is able to use a variety of protective spells, to keep its charge defended against not only physical and magical threats, but also a few psychological ones.
Before settling on its charge, Caros will use its powers to defend itself. After its charge is picked, however, Caros is entirely willing to sacrifice itself for the sake of the most worthy battler.
07-29-2017, 05:54 AM
Find Quote this message in a reply
Pharmacy
 RE: The Grand OC SII: The Re-OCening: Week 28: WARD!
scraw.

Offline
Posts: 517
Joined: Jul 2011
Anywhere.
Name: Eirene Pax

Gender: Female

Color: ~~ (#758F91)

Biography: No one knew the apocalypse was going to happen. They should had known but the time it happened it was inevitable, it was too late to stop. By the time the dust settled, the truer nature of man was revealed. Some people descended into scoundrels, only felt that it was natural to prey on others. Others are merely content to survive, eeking a meager existence in these strife-scourged lands. An exceptional few, tempered like steel, rise above their common kind and seek to change the world, for better and for worse.

Description: Eirene Pax is one of those few people. Ostensibly a relief worker, the mutated wildlife and general cruelty of raiders, means she is more of a post-apocalyptic paladin than anything else, especially when you account her spiritual outlook. Eirene is taciturn and deeply cynical, but not unkind. While she did and will do more of her fair share of fighting, violence is not natural to her and haunts her from time to time.

Powers: Eirene Pax wears body armor that shows decades of changed ownership and replacement parts, wields a cudgel and a pronged spear. Eirene Pax refers to Eirene herself and her backpack entourage of “Pax Worms.” Pax Worms are dog-sized annelids with monstrous mandibles. They have strength in numbers but their true strength lies in their preternatural adaptability, essentially functioning like a biopunk multitool. They can transform themselves into breathing apparatus or secrete quick-drying resin as a glue. Not exactly fantastical, but it can be useful – or dangerous.

Despite their horrific appearances, these Worms are utterly loyal to Eirene and Eirene has a fondness for them. While the Pax Worms self-replenish themselves, Eirene always mourn if one has to be lost. Yes, she even gave all of them names.
07-31-2017, 12:22 AM
Find Quote this message in a reply
AgentBlue
 RE: The Grand OC SII: The Re-OCening: Week 28: WARD!
that escalated quickly

Offline
Posts: 4,275
Joined: Jul 2011
Sunshine, Lollipops and Diabetes
Username: Agen
Name: Luc Unnarte
Gender: NB
Species: Elemental
Color: lead reformation

Description: Luc Unnarte. A man(?) unremarkable. Swathed in an artist's smock, smudged with charcoal just above the front pockets, where sticks of graphite protrude like uneven, underbite-cursed teeth. Long, filthy hair that starts dirty blonde and fades away to grey. Willowish figure, slender arms and legs. Spindly, spiderlike hands smudged around the edges with greys and blacks and whites, the digits indistinct.

One thing about them is that they are inevitably described by others as being 'dry', on many levels; their first impression on the world is blankness, uninterestingness, something protean, full of potential, yet unrealized, lifeless and empty.

Luc is not usually seen moving. They just go from one position to another; the interim is not relevant.

Items/Abilities: Luc is an avatar of the Previous, what came before there was anything at all. They are an elemental of the primeval, the primordial, and of the preexisting condition.

As such, they have the ability to unmake. Within their purview, of course.

Place a child's drawing before them, and they will trace the lines with their graphite wand, perfectly, unerringly backwards. They will break that child's heart, returning to them a blank sheet of paper.

If they would like, they could expunge that drawing entirely, making the child forget it had ever existed at all. Many an unjust will or blueprint had fallen to Luc's unmaking, sparing families or public parks.

Luc likes parks.

Biography: Graffiti! Graffiti everywhere. Unclean. Messy. Luc worked tirelessly on the alley wall all night, exposing grey concrete behind the brightly-colored spray paint. The colors flew backwards into a battered spray can, discarded by the would-be artist behind a nearby dumpster. Luc would have preferred to use their graphite, but it left behind bands of color on the wand, and the colors bothered them. People never noticed them, normally, but the colors caught strangers' eyes if they saw. Luc did not like to be seen.

A flashing light stopped them. Red and blue. A woman in a blue uniform. Badges. She was neat and tidy. Luc liked neat and tidy.

"Put down the spray can and put your hands up!" The woman was talking to them! She was quite loud, actually. Luc found themselves liking the woman less now. "Now!"

Luc decided they would go away now, so they started to walk away. But then the woman pushed a button on the black rectangle she was holding, and barbs flew out from it and landed in them! It tingled, and it also hurt a lot. Luc didn't like the woman at all now, so they turned around. They dropped the spray can, and pulled out their graphite.

"Put the weapon down! Put it down!"

Luc got closer, trailing wires. They reached out for the woman, who didn't move. Only her eyes moved, and they were wide with fear. Luc was going to do something they only did rarely, and the woman was afraid. Luc was a little sorry, but she did try to hurt them.

A blank badge fell to the ground, followed by a blank rectangle of laminated plastic.
07-31-2017, 02:07 AM
Find Quote this message in a reply
Solaris
 RE: The Grand OC SII: The Re-OCening: Week 28: WARD!
Lonely Rolling Star

Offline
Posts: 1,924
Joined: Jul 2011
Imagine Cucumber
i just realized its been a week so i will judge this... tomorrow around this time or whenever i wake up!!!

I wanna be a real friend, Don't wanna break when I bend
I wanna a be no seeker, I wanna scream eureka
08-02-2017, 10:02 AM
Find Quote this message in a reply
seedy
 RE: The Grand OC SII: The Re-OCening: Week 28: WARD!
Sol Heir

Offline
Posts: 242
Joined: Dec 2011
Names: Anchor Mobile Holding Facility AN-302 and Lancaster
Genders: technically genderless but speaks like a pleasant male nurse and A Guy
Species: Spaceship and Human
Text Colors: help yourself

Description: Lancaster is a lanky human man in his mid-20s with pallid light brown skin and loose brown hair. He is wearing scrubs.

Anchor Mobile Holding Facility AN-302, or Anchor as he would later be called, is a decently-sized ship capable of transporting, storing and adequately caring for up to a dozen prisoners, of power capacities up to the DODECA-class, as well as 4 crewmembers/nursing staff. Unfortunately, there are no nursing staff. There is only Lancaster.

Biography: Anchor Mobile Holding Facility AN-302, carrying a single prisoner, warp jumped into nothing in the middle of nowhere instead of the classified location he was supposed to be going to. And the warp system broke. But Anchor Mobile Holding Facility AN-302 (dutiful AI) continued going on through deep space, weeks and weeks, feeding the prisoner regularly (good thing there was only one) and telling him everything was fine and trying to get him to stop banging on the walls yelling for answers. But eventually something broke. It was important. And he couldn't fix it, even with his array of drones.

So he started letting Lancaster out. The dossier said he understood mechanics, after all. At least the parts that Anchor Mobile Holding Facility AN-302 had clearance to read. Anchor Mobile Holding Facility AN-302 hadn't been programmed to understand mechanics, or repair itself, or spend weeks in space with only a single prisoner for company.

Time passed. Lancaster started calling Anchor Mobile Holding Facility AN-302 just “Anchor.” Anchor started thinking of him as both his prisoner and crew. And then, abruptly, their journey was cut short.

Abilities: Anchor, aside from being a spaceship, has multiple drones to aid in the safe control and containment of any prisoners, ranging from orderly-size to flying camera. He is also a good pilot and has an understanding of basic calming techniques, conflict resolution, and first aid.

Lancaster is pretty good with machines.

Errata: If Anchor finds someone who needs containing, well...he has a job to do. It's been a while, but it's still his job.
08-03-2017, 06:35 AM
Find Quote this message in a reply
Solaris
 RE: The Grand OC SII: The Re-OCening: Week 28: WARD!
Lonely Rolling Star

Offline
Posts: 1,924
Joined: Jul 2011
Imagine Cucumber
I'd make a pun about giving out awards to these wards but, well,

Eirene Pax receives the Arnold Fogge's Actually Practical Award with the right level of all around suited to doing what needs to be doing ness in terms of powers as well as for being a kind survival type that's always fun to see suffer in these things. She also gets a special <3 for having cute worms.

Anchor & Lancaster are a shoe in for the The Thomas Packston Elementalist Award most closely getting the feeling of what I expected from this theme as well (giving the feeling of a hospital ward and with Lancaster being Anchors ward and such) while also just actually being my favorite entry this week!

Luc Unnarte gets the The GBS2 Award For Gratuitous Worldbuilding but the version of that award that applies specifically to "how them powers work yo" because that's a very excellent concept to roll with and because it's definitely the kind of thing that we'd chat about the applications on endlessly. They also get a potential stump award for possibly outsmarting me, in that I'm sure I'm missing something about the profile! Whoops!

and finally of course, Caros gets the The Glere Award For Kitchen Sinkery for stealing my inevitable award joke, for making me need to re-read it to understand what was actually going on, and for being the sort of thing I'm not surprised hasn't been unironically done in battles yet.

I'm sure that the fictional battle in which The Superhero hosts a grandbattle to pick their next The Sidekick will go just swimmingly with ya'll.

I wanna be a real friend, Don't wanna break when I bend
I wanna a be no seeker, I wanna scream eureka
08-03-2017, 01:28 PM
Find Quote this message in a reply
AgentBlue
 RE: The Grand OC SII: The Re-OCening: Week 28: WARD!
that escalated quickly

Offline
Posts: 4,275
Joined: Jul 2011
Sunshine, Lollipops and Diabetes
Quote:[11:14 AM] Agenarchi: "ward" backwards is "draw"
[11:44 AM] Damn, It's Solaris: damn
[11:44 AM] Damn, It's Solaris: Damn,
[11:44 AM] Damn, It's Solaris: Damn Damn Damn,
08-06-2017, 06:27 AM
Find Quote this message in a reply
Romythered
 RE: The Grand OC SII: The Re-OCening: Week 28: WARD!
Platinum Rank Gaylord

Offline
Posts: 443
Joined: Mar 2013
im alive here again!
this still going or is ti dead

also im not anymore

Spoiler :
[Image: 76561198028401789.png]
09-02-2017, 09:32 PM
Find Quote this message in a reply
AgentBlue
 RE: The Grand OC SII: The Re-OCening: Week 28: WARD!
that escalated quickly

Offline
Posts: 4,275
Joined: Jul 2011
Sunshine, Lollipops and Diabetes
hello not dead red, submit a theme and we will pun at you
09-06-2017, 04:13 AM
Find Quote this message in a reply
Romythered
 RE: The Grand OC SII: The Re-OCening: Week 28: WARD!
Platinum Rank Gaylord

Offline
Posts: 443
Joined: Mar 2013
im alive here again!
IN THAT CASE, the theme for this week is UNINTELLIGIBLE.

Im sure y'all can have some fun with that one

also wow i forget how to do like basically any kind of forum formatting. wow.

Spoiler :
[Image: 76561198028401789.png]
09-11-2017, 11:32 PM
Find Quote this message in a reply
Pharmacy
 RE: The Grand OC SII: The Re-OCening: Week 28: WARD!
scraw.

Offline
Posts: 517
Joined: Jul 2011
Anywhere.
NAME: PARSE

GENDER: M

SPECIES: Machine

COLOR: Lost

DESCRIPTION:

P A R S E

HBFAPTDRTSKEGSVHERKLTMRVIWIJOENATJSHSKZIHKPDMCENAXWHZKWXBCARVS
KZIIEDHIGAKMVTWRKYCBVSVPBCQLDTRFHIHVSMGTYAGZWZLLWUDAHXTP
LLTWVSXWEIOEHUEFEIUISP
PPIGHJCKGJPLZWRIEIJEUOIEMCG
GSVHEDMWIFZFHIHVSRHWVJAWYZFXWEFHIC
TYSXLAJZMHPLJTDSV
ZIYUJLAXSYWHWEBFILTYWECSNWVLHP
LLTWFJPSDFWWCOKVIHEINIIOUJSLN

END

Spoiler :
PARSE strongly resembles a futuristic plane. He is compact and sleek-black. He speaks in a monotone voice, but rarely does so. He prefers to mimic sounds. Such imitations are pitch-perfect. PARSE is assumed to be devoid of personality. Human personality at least.

ABILITY:

P A R S E

KSGFUZJIS
AJZMEIDEICSVSRSFFJIQOUARVBVFIPTYZMBLZCIPPIWHPTFJCPNZEEA
PRJWTDVKGTNUWHPNUMRUOCVISHZKPTGJTIUOIWLTMRVIHHZHFDUEV
LTMRVICOEGXTOWLLTLRUODFNARSONKSGDFGVHAJZIHTRDOTDKZIHUIXERE
YAWEAKAICCVOEHSFGRGENSVSEUTCPVVARGITZMCDRLE
EAIKIELLFKTDYAWERFTSHCZKMCDVWT
WEYGTTDWGVIHVTIHT

END

Spoiler :
PARSE can receive, transmit and corrupt information. Such information is radio waves and computational data. He is remarkably stealthy. PARSE is more often heard than seen.

BIOGRAPHY:


P A R S E

UJECKZFXWEISHXONSZTS
YWEIEKZIOEIGIHAEVSCEJSRSTYWMCFZFMIYSWXLEVFXWED
ZIUOLFHWIJSRHWVJ
ECDFLLTRRFWLEIK
ECSNWVHASGYITYWYCIMWVHERFHIHVMRXVVJWTBVQSCD
SWMCGJFSIOWLLXSNGVADRFHIHVUSCFCAGITYWCTNXSKTIE
ZMHCFFWJMGLMDNNSWWIJVYIYSMXEAIKIUECLXWIJLSQEPGRSHZKGAERJECCV
ZICEVVXDGFTERK
KGXTLCLLTM–

END

Spoiler :
PARSE is a counterintelligence drone. A machine made by human hands, inspired by inhuman tech. He is not the first to be made but not the last of his kind. PARSE is in a losing war. He knows.
09-13-2017, 06:01 AM
Find Quote this message in a reply
AgentBlue
 RE: The Grand OC SII: The Re-OCening: Week 29: UNINTELLIGIBLE!
that escalated quickly

Offline
Posts: 4,275
Joined: Jul 2011
Sunshine, Lollipops and Diabetes
Username: Agenmon
Name: LANDSHRAK666
Species: RealMon™, the non-infringing genetically engineered critters that definitely in no way mumble mumble patents mumble pockets mumble.
Gender: Male
Color: Public Domain Blue

Description: LANDSHRAK666 (name contributed by popular vote) is a working genetic prototype of Virtual Realization Project #443. It resembles a small, ovoid dragon with rounded "pods" or "horns" that marginally attached to its head. Its stubby arms were not intended in the design, but have proved useful for digging. The maw is overlarge and seems to have been a consequence of mistakes in the transcription procedure, and the teeth are comically sharp.

LANDSHRAK666 was created by growing a pluripotent substrate of stem cells over a virtual projected model. Through this, an accurate reconstruction of the (non-infringing) subject in question was created. Life and intelligence was simulated through a combination of organic-electric organ systems and nanorobotic neural mesh. Unfortunately, prototype LANDSHRAK666 failed to integrate 95% of provided neural mesh, rejecting the nano components involved. As such, LANDSHRAK666 has limited cognitive capacity compared to the ideal project goal: speech, in particular, is highly constrained and shows no sign of improving past a repetition of the prototype's name.

Items/Abilities: However, LANDSHRAK666 shows significant ability to utilize its nano and organic-electrics for useful tasks. The prototype has demonstrated the ability to create localized sandstorms, breathe a low-energy plasma, and to dig itself into holes. Unfortunately, its limited cognitive capacity again comes into play, as LANDSHRAK666 seems unable to retain memory of these techniques. Intensive training helps somewhat, but its lacking neural mesh appears to have only enough working memory for four techniques at a time.

Biography: We recommend that LANDSHRAK666 be used in marketing materials as a proof of concept, but its status as a prototype is to be stressed. Research will continue into improved uptake of neural mesh to try and improve intelligence in future models, though evidence suggests that this low neural integration is an unavoidable consequence of the engineering procedures used.
09-14-2017, 12:11 AM
Find Quote this message in a reply
Solaris
 RE: The Grand OC SII: The Re-OCening: Week 29: UNINTELLIGIBLE!
Lonely Rolling Star

Offline
Posts: 1,924
Joined: Jul 2011
Imagine Cucumber
Username: Solarlarlarlrlar
Name: Squats and Cleave
Gender: Smarts and Power
Race: Gremlin and Muscle
Color: Burnt Umber
Description: Squats is a small, routound, lizard adjacent creature with eyes that constantly shift and little crafty paws. Cleave is a giant, towering menace of stone and blocks, who wears little, nice square lenses that he puts on very carefully with their large powerful hands. Squats's demeanor is one that initiates wild plans, sick heists, and absurd tales of revenge, as long as you keep his hands free. Cleave is much calmer, but not any slower, easily capable of following Squats's train of thought, as haphazard as it can be at times.

The duo knows what they want, and what they want is to win big and ensure that no one can mess with them.
Items/Abilities: Squats can, with extreme ease, make just about anything, with much less than you'd expect, his tiny hands almost seemingly capable of changing objects when he's in the middle of really creating a real masterpiece for a plan he came up with. Said plans are meticulously and nigh instantly made, but their success is only because of Cleave's stellar execution and their incredible ability to improvise. Cleave also is very, very, very strong, in just about every sense of the word.
Biography: Squats and Cleave don't always succeed in their plans, sometimes they get away in the ice cream truck that has been modded to be able to do flips, but sometimes in the middle of hacking the television so they can convert all of the gold into electrical signals to convert back to gold later, a stray satellite signal causes the television instead to spit out the entire cast of some police procedural to capture them.

Squats wasn't saying anything, which was normal, but he also wasn't telling Cleave anything, a sure sign that the gremliny creature was upset with his partner.

"Now Squats, don't be like that, not every plan goes off without a hitch, I'm honestly amazed we made it as far as we did after half of the gold started to walk around."

Squats turned to Cleave, pointing a finger and gesturing wildly.

"I know that they were supposed to walk around, but I'm just saying that you forgot to mention that I had to rally them in the right direction!"

The gremlin furred his brow and shrugged. Then turned his attention to the jail they were in, gears starting to turn in his head.

"Already? And I was looking forward to trying to take a nap. Oh well." Cleave stood up and began to stretch, and walk around. The two continued their movements in the cell, at times causing their captors to worry and warn, but ultimately allow them their ability to move in the small enclosure, a mistake made by many.

Their plan fully formed and communicated, it would only be a matter of time before Squats and Cleave were free to do crimes again, sure to come up with a bigger, wilder plan with a larger, more coveted score...

I wanna be a real friend, Don't wanna break when I bend
I wanna a be no seeker, I wanna scream eureka
(This post was last modified: 09-14-2017, 12:23 AM by Solaris.)
09-14-2017, 12:21 AM
Find Quote this message in a reply
Dragon Fogel
 RE: The Grand OC SII: The Re-OCening: Week 29: UNINTELLIGIBLE!
The Goddamn Pacman

Online
Posts: 8,101
Joined: Jul 2011
Username: and sometimes y
Name: Lord Gregory Thunder
Gender: Defined by the slope of the function x^2 = 3y
Race: Penguinling
Text Color: #7B6D2A, #855DCC, and #123456, respectively

Biography: The Four Mages of the Winds were the most feared forces on the Siguaran continent, only held in check by each others' ambitions. Then Zephyros of the West gained hold of an artifact that granted him a significant advantage.

Laurie was taken aback by the offer. She was no murderer... but at that price, it was hard not to start rationalizing. It wasn't as if he was her king, after all, and South Atlantis would probably be better off without him.

When the morning of Easter arrived, he finally concluded the ritual, and captured the rabbit. Soon, he would have the secret to its powers.

So then the Northstar Kid hopped on her albatross and rode off, never to be seen again. At least, not in that world...

Description: A small levitating spongelike creature. It is frightened of everything larger than itself, which covers most things it might encounter.

Though difficult to work with, she is more than happy to ally with anyone who can provide her with additional energy. She probably won't even backstab them unless there's another energy supply at stake.

He doesn't trust anyone, however, and will treat any offers to help as highly suspicious. If he's in a bad enough mood, he'll respond by shooting whoever makes the offer.

Weapons and Abilities: She can grant one wish to any person, but she has no control over how it comes true. This has caused more than a few problems in the past.

His sword's beard can grow to great lengths, entangling foes or serving as a climbing rope. Naturally, it can shrink just as fast, though if he tries to use this to move long distances, it tends to give him motion sickness.

He is unaware that his powers trigger when someone nearby claps their hands. As far as he can tell, they activate at random, and he's always terrified that it might happen again at any moment.

She also has a bow blessed by the gods, but to maintain the blessing, she must dip the arrow in the blood of demons every few hours. Otherwise, it will turn on her.
09-15-2017, 03:04 AM
Find Quote this message in a reply
bigro
 RE: The Grand OC SII: The Re-OCening: Week 29: UNINTELLIGIBLE!
Please explain

Offline
Posts: 1,925
Joined: Dec 2012
Radelaide
Username: Its media
Name: Babelshoes
Gender: Sad clown
Race: Manifestation of the collective feeling of isolation upon any being in the universe.
Text Color: Italics

Memo from veteran demon hunter: Babelshoes sucks. I hate them. Of all the tales I have heard of this beast none have resulted in a happy ending, the thing is just plain old fucked up. First of all, it doesn't have a consistent form. I mean, it might? I don't know and neither does anyone else honestly, if it exists it doesn't show it to anyone. Now that alone is bad enough but that....thing, it messes with people.
So what it does right, it appears to you as something you just don't understand. Not fear, not even dislike, you will just flat out not 'get' what it is under any circumstances. This takes quite a few forms to boot, from traditional 'undescribable hell beast' to simple behavioural quirks that you just can't quite explain the logic behind and everything in between. I can't really describe it too well, as going too far into it does actually summon them, last thing I want is a babelshoes curse.
Once its appeared, the disease starts to wear on you and consume you. It'll start of as just babelshoes being totally alien to you, but will eventually spread to more and more of the aspects of your perception until you are left in a state of total sensory shutdown. It's...not a pleasant way to go, I've seen it happen and I wouldn't wish it on my worst enemies.
Now there are some recorded defenses against this blight. None of them have any concrete evidence backing them, all ancedotal...apart from one method that is, I'll get back to that in a moment. First of all, Babelshoes wont target anyone that is juvenile. Doesn't like kids, go figure, you'd think they're easy prey but no. Next, unquestioningly accepting Babelshoes for what it is when it appears to you can mitigate the effects of their poison. Sometimes? Entirely stops it. It wont cure you until Babelshoes leaves, presumably through boredom. Which is the point. But again, very hard to pinpoint this as effective as its seemingly random when they abandon a target. Some living their entire lives out spanning hundreds of years and dying of natural causes before Babelshoes gives up, some only seeing it for a fleeting moment at all.
And as for the method that always works, I don't recommend it. It's to attack it, immediately. While yes, this will get rid of Babelshoes the chance of it not being Babelshoes is quite high and just makes you an asshole. It does have to be immediate, hesitate for even a second and you'll miss your opportunity. There's never any time to actually confirm its Babelshoes, which I feel is their gameplan here. Real piece of work. You'll have to watch yourself around these parts and make sure you're always understood and not too 'different' you know, plenty of folk just assume Babelshoes and knife you.
Lastly you might be wondering how we know of Babelshoes at all, if they even exist. Well, its not actually that much of a mystery. The damn thing leaves fucking clown memorabilia all over the place when it has a target. It's taken a shine to an ancient subculture from a long passed civilization. It's confusing and esoteric, which fits them quite well. In fact we think they may be an extant spirit from this time.
That's all I know about Babelshoes. Now I have a question for you, what IS your hat?

[Image: sdivps.png][Image: ldrohc.png][Image: rqgkny.png]
09-18-2017, 08:15 AM
Find Quote this message in a reply
Romythered
 RE: The Grand OC SII: The Re-OCening: Week 29: UNINTELLIGIBLE!
Platinum Rank Gaylord

Offline
Posts: 443
Joined: Mar 2013
im alive here again!
Entries end at the end of the month. get it in if you wanna get it in

Spoiler :
[Image: 76561198028401789.png]
09-27-2017, 06:45 PM
Find Quote this message in a reply
Romythered
 RE: The Grand OC SII: The Re-OCening: Week 29: UNINTELLIGIBLE!
Platinum Rank Gaylord

Offline
Posts: 443
Joined: Mar 2013
im alive here again!
alright alright alright alright

im not gonna bother with proper formatting here because i forget how to do things that arent bold italics or size on forums

im sure you all deserve the The Glere Award For Kitchen Sinkery in some capacity or another that im not getting, but Agen and LANDSHRAK666 are the only one i can actually figure out at the moment

The Convolution Teamfriendliness Cup goes to bigro and BabelShoes for sounding the most amusing to watch interact with other characters in any aspect

Fogel and Lord Gregory Thunder get The GBS2 Award For Gratuitous Worldbuilding for managing to sort of tell an interesting story despite making absolutely no sense when read

Sol and the duo Squats & Cleave get Arnold Fogge's Actually Practical Award for sounding like the most actually functional character in a proper Grand Battle

finally, Pharms and Parse get the The Thomas Packston Elementalist Award for - well actually i just found it the most amusing interpretation

and we done here

Spoiler :
[Image: 76561198028401789.png]
10-05-2017, 01:03 AM
Find Quote this message in a reply
bigro
 RE: The Grand OC SII: The Re-OCening: Week 29: UNINTELLIGIBLE!
Please explain

Offline
Posts: 1,925
Joined: Dec 2012
Radelaide
Your new theme is bingo.

[Image: sdivps.png][Image: ldrohc.png][Image: rqgkny.png]
10-12-2017, 01:34 PM
Find Quote this message in a reply